Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
BGLAP monoclonal antibody (M02), clone 2D5
Abnova
BGLAP monoclonal antibody (M02), clone 2D5
Ref: AB-H00000632-M02
BGLAP monoclonal antibody (M02), clone 2D5
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant BGLAP.
Información adicional
Size
100 ug
Gene Name
BGLAP
Gene Alias
BGP|OC|PMF1
Gene Description
bone gamma-carboxyglutamate (gla) protein
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
632
Clone Number
2D5
Iso type
IgG1 Lambda
Enviar un mensaje
BGLAP monoclonal antibody (M02), clone 2D5
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*