BGLAP monoclonal antibody (M02), clone 2D5
  • BGLAP monoclonal antibody (M02), clone 2D5

BGLAP monoclonal antibody (M02), clone 2D5

Ref: AB-H00000632-M02
BGLAP monoclonal antibody (M02), clone 2D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BGLAP.
Información adicional
Size 100 ug
Gene Name BGLAP
Gene Alias BGP|OC|PMF1
Gene Description bone gamma-carboxyglutamate (gla) protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 632
Clone Number 2D5
Iso type IgG1 Lambda

Enviar un mensaje


BGLAP monoclonal antibody (M02), clone 2D5

BGLAP monoclonal antibody (M02), clone 2D5