Ver mas grande
TNFRSF17 monoclonal antibody (M08), clone 3D1
AB-H00000608-M08
Producto nuevo
TNFRSF17 monoclonal antibody (M08), clone 3D1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TNFRSF17 |
| Gene Alias | BCM|BCMA|CD269 |
| Gene Description | tumor necrosis factor receptor superfamily, member 17 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TNFRSF17 (AAH58291.1, 5 a.a. ~ 50 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 608 |
| Clone Number | 3D1 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TNFRSF17.