AB-H00000608-M07
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | TNFRSF17 |
Gene Alias | BCM|BCMA|CD269 |
Gene Description | tumor necrosis factor receptor superfamily, member 17 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,ELISA |
Immunogen Prot. Seq | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | TNFRSF17 (AAH58291.1, 5 a.a. ~ 50 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 608 |
Clone Number | 1A4 |
Iso type | IgG1 Kappa |