Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
BAI2 polyclonal antibody (A01)
Abnova
BAI2 polyclonal antibody (A01)
Ref: AB-H00000576-A01
BAI2 polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant BAI2.
Información adicional
Size
50 uL
Gene Name
BAI2
Gene Alias
-
Gene Description
brain-specific angiogenesis inhibitor 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq
DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BAI2 (NP_001694, 22 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
576
Enviar un mensaje
BAI2 polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*