Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ATP5I monoclonal antibody (M01), clone 1E6
Abnova
ATP5I monoclonal antibody (M01), clone 1E6
Ref: AB-H00000521-M01
ATP5I monoclonal antibody (M01), clone 1E6
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant ATP5I.
Información adicional
Size
100 ug
Gene Name
ATP5I
Gene Alias
ATP5K|MGC12532
Gene Description
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA
Immunogen Prot. Seq
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATP5I (AAH03679, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
521
Clone Number
1E6
Iso type
IgG2a Kappa
Enviar un mensaje
ATP5I monoclonal antibody (M01), clone 1E6
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*