Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ATP2A1 monoclonal antibody (M04), clone 5H8
Abnova
ATP2A1 monoclonal antibody (M04), clone 5H8
Ref: AB-H00000487-M04
ATP2A1 monoclonal antibody (M04), clone 5H8
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
Información adicional
Size
100 ug
Gene Name
ATP2A1
Gene Alias
ATP2A|SERCA1
Gene Description
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
487
Clone Number
5H8
Iso type
IgG1 Kappa
Enviar un mensaje
ATP2A1 monoclonal antibody (M04), clone 5H8
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*