Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ATP1B2 monoclonal antibody (M04), clone 4E3
Abnova
ATP1B2 monoclonal antibody (M04), clone 4E3
Ref: AB-H00000482-M04
ATP1B2 monoclonal antibody (M04), clone 4E3
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ATP1B2.
Información adicional
Size
100 ug
Gene Name
ATP1B2
Gene Alias
AMOG
Gene Description
ATPase, Na+/K+ transporting, beta 2 polypeptide
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
IRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGAN
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATP1B2 (NP_001669.3, 84 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
482
Clone Number
4E3
Iso type
IgG2a Kappa
Enviar un mensaje
ATP1B2 monoclonal antibody (M04), clone 4E3
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*