ATOH1 monoclonal antibody (M11), clone 1A8
  • ATOH1 monoclonal antibody (M11), clone 1A8

ATOH1 monoclonal antibody (M11), clone 1A8

Ref: AB-H00000474-M11
ATOH1 monoclonal antibody (M11), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ATOH1.
Información adicional
Size 100 ug
Gene Name ATOH1
Gene Alias ATH1|HATH1|MATH-1|bHLHa14
Gene Description atonal homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATOH1 (NP_005163, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 474
Clone Number 1A8
Iso type IgG2b Kappa

Enviar un mensaje


ATOH1 monoclonal antibody (M11), clone 1A8

ATOH1 monoclonal antibody (M11), clone 1A8