ATOH1 monoclonal antibody (M08), clone 2A12
  • ATOH1 monoclonal antibody (M08), clone 2A12

ATOH1 monoclonal antibody (M08), clone 2A12

Ref: AB-H00000474-M08
ATOH1 monoclonal antibody (M08), clone 2A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATOH1.
Información adicional
Size 100 ug
Gene Name ATOH1
Gene Alias ATH1|HATH1|MATH-1|bHLHa14
Gene Description atonal homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATOH1 (NP_005163.1, 266 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 474
Clone Number 2A12
Iso type IgG2a Kappa

Enviar un mensaje


ATOH1 monoclonal antibody (M08), clone 2A12

ATOH1 monoclonal antibody (M08), clone 2A12