Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ATF4 monoclonal antibody (M12), clone 2B3
Abnova
ATF4 monoclonal antibody (M12), clone 2B3
Ref: AB-H00000468-M12
ATF4 monoclonal antibody (M12), clone 2B3
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant ATF4.
Información adicional
Size
100 ug
Gene Name
ATF4
Gene Alias
CREB-2|CREB2|TAXREB67|TXREB
Gene Description
activating transcription factor 4 (tax-responsive enhancer element B67)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATF4 (AAH16855, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
468
Clone Number
2B3
Iso type
IgG2a Kappa
Enviar un mensaje
ATF4 monoclonal antibody (M12), clone 2B3
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*