ASPH MaxPab rabbit polyclonal antibody (D03)
  • ASPH MaxPab rabbit polyclonal antibody (D03)

ASPH MaxPab rabbit polyclonal antibody (D03)

Ref: AB-H00000444-D03
ASPH MaxPab rabbit polyclonal antibody (D03)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ASPH protein.
Información adicional
Size 100 uL
Gene Name ASPH
Gene Alias BAH|CASQ2BP1|HAAH|JCTN|junctin
Gene Description aspartate beta-hydroxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASPH (NP_115856.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 444

Enviar un mensaje


ASPH MaxPab rabbit polyclonal antibody (D03)

ASPH MaxPab rabbit polyclonal antibody (D03)