ASGR1 monoclonal antibody (M01), clone 1E12
  • ASGR1 monoclonal antibody (M01), clone 1E12

ASGR1 monoclonal antibody (M01), clone 1E12

Ref: AB-H00000432-M01
ASGR1 monoclonal antibody (M01), clone 1E12

Información del producto

Mouse monoclonal antibody raised against human ASGR1.
Información adicional
Size 100 ug
Gene Name ASGR1
Gene Alias HL-1|ASGPR|ASGPR1|CLEC4H1
Gene Description asialoglycoprotein receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,ELISA
Immunogen Prot. Seq GRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen A synthetic peptide corresponding to human ASGR1
Storage Buffer In 1x PBS, pH 7.4
Gene ID 432
Clone Number 1E12
Iso type IgG1 Kappa

Enviar un mensaje


ASGR1 monoclonal antibody (M01), clone 1E12

ASGR1 monoclonal antibody (M01), clone 1E12