STS MaxPab rabbit polyclonal antibody (D01)
  • STS MaxPab rabbit polyclonal antibody (D01)

STS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000412-D01
STS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STS protein.
Información adicional
Size 100 uL
Gene Name STS
Gene Alias ARSC|ARSC1|ASC|ES|SSDD
Gene Description steroid sulfatase (microsomal), isozyme S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMSCHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STS (NP_000342.2, 1 a.a. ~ 583 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 412

Enviar un mensaje


STS MaxPab rabbit polyclonal antibody (D01)

STS MaxPab rabbit polyclonal antibody (D01)