ARSB polyclonal antibody (A01)
  • ARSB polyclonal antibody (A01)

ARSB polyclonal antibody (A01)

Ref: AB-H00000411-A01
ARSB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARSB.
Información adicional
Size 50 uL
Gene Name ARSB
Gene Alias ASB|G4S|MPS6
Gene Description arylsulfatase B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARSB (NP_942002, 166 a.a. ~ 265 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 411

Enviar un mensaje


ARSB polyclonal antibody (A01)

ARSB polyclonal antibody (A01)