Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ARRB2 monoclonal antibody (M01), clone 3G1
Abnova
ARRB2 monoclonal antibody (M01), clone 3G1
Ref: AB-H00000409-M01
ARRB2 monoclonal antibody (M01), clone 3G1
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ARRB2.
Información adicional
Size
100 ug
Gene Name
ARRB2
Gene Alias
ARB2|ARR2|BARR2|DKFZp686L0365
Gene Description
arrestin, beta 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq
NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ARRB2 (AAH07427, 300 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
409
Clone Number
3G1
Iso type
IgG2a Kappa
Enviar un mensaje
ARRB2 monoclonal antibody (M01), clone 3G1
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*