Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
RHOH monoclonal antibody (M04), clone 2G7
Abnova
RHOH monoclonal antibody (M04), clone 2G7
Ref: AB-H00000399-M04
RHOH monoclonal antibody (M04), clone 2G7
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant RHOH.
Información adicional
Size
100 ug
Gene Name
RHOH
Gene Alias
ARHH|TTF
Gene Description
ras homolog gene family, member H
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA
Immunogen Prot. Seq
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVVTQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
RHOH (AAH14261.1, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
399
Clone Number
2G7
Iso type
IgG2a Kappa
Enviar un mensaje
RHOH monoclonal antibody (M04), clone 2G7
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*