ARHGDIG MaxPab mouse polyclonal antibody (B01P)
  • ARHGDIG MaxPab mouse polyclonal antibody (B01P)

ARHGDIG MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000398-B01P
ARHGDIG MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARHGDIG protein.
Información adicional
Size 50 ug
Gene Name ARHGDIG
Gene Alias RHOGDI-3
Gene Description Rho GDP dissociation inhibitor (GDI) gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGDIG (NP_001167, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 398

Enviar un mensaje


ARHGDIG MaxPab mouse polyclonal antibody (B01P)

ARHGDIG MaxPab mouse polyclonal antibody (B01P)