ARHGDIB polyclonal antibody (A01)
  • ARHGDIB polyclonal antibody (A01)

ARHGDIB polyclonal antibody (A01)

Ref: AB-H00000397-A01
ARHGDIB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ARHGDIB.
Información adicional
Size 50 uL
Gene Name ARHGDIB
Gene Alias D4|GDIA2|GDID4|LYGDI|Ly-GDI|RAP1GN1|RhoGDI2
Gene Description Rho GDP dissociation inhibitor (GDI) beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGDIB (AAH09200, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 397

Enviar un mensaje


ARHGDIB polyclonal antibody (A01)

ARHGDIB polyclonal antibody (A01)