Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ARHGDIA polyclonal antibody (A01)
Abnova
ARHGDIA polyclonal antibody (A01)
Ref: AB-H00000396-A01
ARHGDIA polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length recombinant ARHGDIA.
Información adicional
Size
50 uL
Gene Name
ARHGDIA
Gene Alias
GDIA1|MGC117248|RHOGDI|RHOGDI-1
Gene Description
Rho GDP dissociation inhibitor (GDI) alpha
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ARHGDIA (AAH16031, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
396
Enviar un mensaje
ARHGDIA polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*