Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
RHOC polyclonal antibody (A01)
Abnova
RHOC polyclonal antibody (A01)
Ref: AB-H00000389-A01
RHOC polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant RHOC.
Información adicional
Size
50 uL
Gene Name
RHOC
Gene Alias
ARH9|ARHC|H9|MGC1448|MGC61427|RHOH9
Gene Description
ras homolog gene family, member C
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
SLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
RHOC (NP_786886, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
389
Enviar un mensaje
RHOC polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*