Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ARL4D purified MaxPab mouse polyclonal antibody (B01P)
Abnova
ARL4D purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00000379-B01P
ARL4D purified MaxPab mouse polyclonal antibody (B01P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human ARL4D protein.
Información adicional
Size
50 ug
Gene Name
ARL4D
Gene Alias
ARF4L|ARL6
Gene Description
ADP-ribosylation factor-like 4D
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ARL4D (NP_001652.2, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
379
Enviar un mensaje
ARL4D purified MaxPab mouse polyclonal antibody (B01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*