Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
TRIM23 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
TRIM23 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00000373-D01P
TRIM23 purified MaxPab rabbit polyclonal antibody (D01P)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human TRIM23 protein.
Información adicional
Size
100 ug
Gene Name
TRIM23
Gene Alias
ARD1|ARFD1|RNF46
Gene Description
tripartite motif-containing 23
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESIIRCDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQHQVHAIEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIV
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
TRIM23 (NP_001647.1, 1 a.a. ~ 574 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
373
Enviar un mensaje
TRIM23 purified MaxPab rabbit polyclonal antibody (D01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*