AR monoclonal antibody (M01), clone 1G3
  • AR monoclonal antibody (M01), clone 1G3

AR monoclonal antibody (M01), clone 1G3

Ref: AB-H00000367-M01
AR monoclonal antibody (M01), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AR.
Información adicional
Size 100 ug
Gene Name AR
Gene Alias AIS|DHTR|HUMARA|KD|NR3C4|SBMA|SMAX1|TFM
Gene Description androgen receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AR (NP_000035, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 367
Clone Number 1G3
Iso type IgG1 kappa

Enviar un mensaje


AR monoclonal antibody (M01), clone 1G3

AR monoclonal antibody (M01), clone 1G3