AQP4 DNAxPab
  • AQP4 DNAxPab

AQP4 DNAxPab

Ref: AB-H00000361-W01P
AQP4 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a partial-length human AQP4 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name AQP4
Gene Alias HMIWC2|MGC22454|MIWC
Gene Description aquaporin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AQP4 (AAH22286.1, 253 a.a. ~ 323 a.a.) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 361

Enviar un mensaje


AQP4 DNAxPab

AQP4 DNAxPab