FASLG polyclonal antibody (A01)
  • FASLG polyclonal antibody (A01)

FASLG polyclonal antibody (A01)

Ref: AB-H00000356-A01
FASLG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant FASLG.
Información adicional
Size 50 uL
Gene Name FASLG
Gene Alias APT1LG1|CD178|CD95L|FASL|TNFSF6
Gene Description Fas ligand (TNF superfamily, member 6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FASLG (AAH17502.1, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 356

Enviar un mensaje


FASLG polyclonal antibody (A01)

FASLG polyclonal antibody (A01)