Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
FAS monoclonal antibody (M08), clone 3D7
Abnova
FAS monoclonal antibody (M08), clone 3D7
Ref: AB-H00000355-M08
FAS monoclonal antibody (M08), clone 3D7
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant FAS.
Información adicional
Size
100 ug
Gene Name
FAS
Gene Alias
ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6
Gene Description
Fas (TNF receptor superfamily, member 6)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
355
Clone Number
3D7
Iso type
IgG1 Kappa
Enviar un mensaje
FAS monoclonal antibody (M08), clone 3D7
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*