FAS monoclonal antibody (M07), clone 7F12
  • FAS monoclonal antibody (M07), clone 7F12

FAS monoclonal antibody (M07), clone 7F12

Ref: AB-H00000355-M07
FAS monoclonal antibody (M07), clone 7F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FAS.
Información adicional
Size 100 ug
Gene Name FAS
Gene Alias ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6
Gene Description Fas (TNF receptor superfamily, member 6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 355
Clone Number 7F12
Iso type IgG1 Kappa

Enviar un mensaje


FAS monoclonal antibody (M07), clone 7F12

FAS monoclonal antibody (M07), clone 7F12