APOH polyclonal antibody (A01)
  • APOH polyclonal antibody (A01)

APOH polyclonal antibody (A01)

Ref: AB-H00000350-A01
APOH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant APOH.
Información adicional
Size 50 uL
Gene Name APOH
Gene Alias B2G1|BG
Gene Description apolipoprotein H (beta-2-glycoprotein I)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APOH (NP_000033, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 350

Enviar un mensaje


APOH polyclonal antibody (A01)

APOH polyclonal antibody (A01)