Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
APOA2 monoclonal antibody (M03), clone 1H6
Abnova
APOA2 monoclonal antibody (M03), clone 1H6
Ref: AB-H00000336-M03
APOA2 monoclonal antibody (M03), clone 1H6
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant APOA2.
Información adicional
Size
100 ug
Gene Name
APOA2
Gene Alias
-
Gene Description
apolipoprotein A-II
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
336
Clone Number
1H6
Iso type
IgG1 Kappa
Enviar un mensaje
APOA2 monoclonal antibody (M03), clone 1H6
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*