APOA1 purified MaxPab mouse polyclonal antibody (B01P)
  • APOA1 purified MaxPab mouse polyclonal antibody (B01P)

APOA1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000335-B01P
APOA1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human APOA1 protein.
Información adicional
Size 50 ug
Gene Name APOA1
Gene Alias MGC117399
Gene Description apolipoprotein A-I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 335

Enviar un mensaje


APOA1 purified MaxPab mouse polyclonal antibody (B01P)

APOA1 purified MaxPab mouse polyclonal antibody (B01P)