APCS polyclonal antibody (A02)
  • APCS polyclonal antibody (A02)

APCS polyclonal antibody (A02)

Ref: AB-H00000325-A02
APCS polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant APCS.
Información adicional
Size 50 uL
Gene Name APCS
Gene Alias MGC88159|PTX2|SAP
Gene Description amyloid P component, serum
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APCS (NP_001630, 117 a.a. ~ 223 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 325

Enviar un mensaje


APCS polyclonal antibody (A02)

APCS polyclonal antibody (A02)