Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
NUDT2 monoclonal antibody (M03), clone S1
Abnova
NUDT2 monoclonal antibody (M03), clone S1
Ref: AB-H00000318-M03
NUDT2 monoclonal antibody (M03), clone S1
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant NUDT2.
Información adicional
Size
100 ug
Gene Name
NUDT2
Gene Alias
APAH1|MGC10404
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
318
Clone Number
S1
Iso type
IgG1 Kappa
Enviar un mensaje
NUDT2 monoclonal antibody (M03), clone S1
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*