ANXA7 purified MaxPab mouse polyclonal antibody (B01P)
  • ANXA7 purified MaxPab mouse polyclonal antibody (B01P)

ANXA7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000310-B01P
ANXA7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANXA7 protein.
Información adicional
Size 50 ug
Gene Name ANXA7
Gene Alias ANX7|SNX|SYNEXIN
Gene Description annexin A7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPGGYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANXA7 (NP_001147.1, 1 a.a. ~ 466 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 310

Enviar un mensaje


ANXA7 purified MaxPab mouse polyclonal antibody (B01P)

ANXA7 purified MaxPab mouse polyclonal antibody (B01P)