Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ANXA4 MaxPab rabbit polyclonal antibody (D01)
Abnova
ANXA4 MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00000307-D01
ANXA4 MaxPab rabbit polyclonal antibody (D01)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human ANXA4 protein.
Información adicional
Size
100 uL
Gene Name
ANXA4
Gene Alias
ANX4|DKFZp686H02120|MGC75105|PIG28|ZAP36
Gene Description
annexin A4
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEK
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
307
Enviar un mensaje
ANXA4 MaxPab rabbit polyclonal antibody (D01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*