AMT purified MaxPab mouse polyclonal antibody (B01P)
  • AMT purified MaxPab mouse polyclonal antibody (B01P)

AMT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000275-B01P
AMT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AMT protein.
Información adicional
Size 50 ug
Gene Name AMT
Gene Alias GCE|GCST|NKH
Gene Description aminomethyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AMT (AAH07546.1, 1 a.a. ~ 289 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 275

Enviar un mensaje


AMT purified MaxPab mouse polyclonal antibody (B01P)

AMT purified MaxPab mouse polyclonal antibody (B01P)