AMPD2 monoclonal antibody (M09A), clone 6A8
  • AMPD2 monoclonal antibody (M09A), clone 6A8

AMPD2 monoclonal antibody (M09A), clone 6A8

Ref: AB-H00000271-M09A
AMPD2 monoclonal antibody (M09A), clone 6A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Información adicional
Size 200 uL
Gene Name AMPD2
Gene Alias -
Gene Description adenosine monophosphate deaminase 2 (isoform L)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 271
Clone Number 6A8
Iso type IgG2a Kappa

Enviar un mensaje


AMPD2 monoclonal antibody (M09A), clone 6A8

AMPD2 monoclonal antibody (M09A), clone 6A8