Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AMPD2 monoclonal antibody (M09A), clone 6A8
Abnova
AMPD2 monoclonal antibody (M09A), clone 6A8
Ref: AB-H00000271-M09A
AMPD2 monoclonal antibody (M09A), clone 6A8
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Información adicional
Size
200 uL
Gene Name
AMPD2
Gene Alias
-
Gene Description
adenosine monophosphate deaminase 2 (isoform L)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
271
Clone Number
6A8
Iso type
IgG2a Kappa
Enviar un mensaje
AMPD2 monoclonal antibody (M09A), clone 6A8
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*