AMELX purified MaxPab mouse polyclonal antibody (B01P)
  • AMELX purified MaxPab mouse polyclonal antibody (B01P)

AMELX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000265-B01P
AMELX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AMELX protein.
Información adicional
Size 50 ug
Gene Name AMELX
Gene Alias AIH1|ALGN|AMG|AMGL|AMGX
Gene Description amelogenin (amelogenesis imperfecta 1, X-linked)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AMELX (NP_001133.1, 1 a.a. ~ 191 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 265

Enviar un mensaje


AMELX purified MaxPab mouse polyclonal antibody (B01P)

AMELX purified MaxPab mouse polyclonal antibody (B01P)