Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AMBN DNAxPab
Abnova
AMBN DNAxPab
Ref: AB-H00000258-W01P
AMBN DNAxPab
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human AMBN DNA using DNAx™ Immune technology.
Información adicional
Size
100 ug
Gene Name
AMBN
Gene Alias
-
Gene Description
ameloblastin (enamel matrix protein)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq
MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPA
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
AMBN (NP_057603.1, 27 a.a. ~ 447 a.a) full-length human DNA
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
258
Enviar un mensaje
AMBN DNAxPab
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*