Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AMBN purified MaxPab mouse polyclonal antibody (B01P)
Abnova
AMBN purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00000258-B01P
AMBN purified MaxPab mouse polyclonal antibody (B01P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human AMBN protein.
Información adicional
Size
50 ug
Gene Name
AMBN
Gene Alias
-
Gene Description
ameloblastin (enamel matrix protein)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPA
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
AMBN (NP_057603.1, 1 a.a. ~ 447 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
258
Enviar un mensaje
AMBN purified MaxPab mouse polyclonal antibody (B01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*