ALPI monoclonal antibody (M03), clone 3A8
  • ALPI monoclonal antibody (M03), clone 3A8

ALPI monoclonal antibody (M03), clone 3A8

Ref: AB-H00000248-M03
ALPI monoclonal antibody (M03), clone 3A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALPI.
Información adicional
Size 100 ug
Gene Name ALPI
Gene Alias IAP
Gene Description alkaline phosphatase, intestinal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALPI (NP_001622, 74 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 248
Clone Number 3A8
Iso type IgG2a Kappa

Enviar un mensaje


ALPI monoclonal antibody (M03), clone 3A8

ALPI monoclonal antibody (M03), clone 3A8