ALOX15 purified MaxPab rabbit polyclonal antibody (D01P)
  • ALOX15 purified MaxPab rabbit polyclonal antibody (D01P)

ALOX15 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000246-D01P
ALOX15 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ALOX15 protein.
Información adicional
Size 100 ug
Gene Name ALOX15
Gene Alias 15-LOX-1
Gene Description arachidonate 15-lipoxygenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALOX15 (AAH29032.1, 1 a.a. ~ 662 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 246

Enviar un mensaje


ALOX15 purified MaxPab rabbit polyclonal antibody (D01P)

ALOX15 purified MaxPab rabbit polyclonal antibody (D01P)