ALOX5 purified MaxPab mouse polyclonal antibody (B01P)
  • ALOX5 purified MaxPab mouse polyclonal antibody (B01P)

ALOX5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000240-B01P
ALOX5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ALOX5 protein.
Información adicional
Size 50 ug
Gene Name ALOX5
Gene Alias 5-LO|5-LOX|5LPG|LOG5|MGC163204
Gene Description arachidonate 5-lipoxygenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALOX5 (NP_000689.1, 1 a.a. ~ 674 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 240

Enviar un mensaje


ALOX5 purified MaxPab mouse polyclonal antibody (B01P)

ALOX5 purified MaxPab mouse polyclonal antibody (B01P)