AKR1B1 purified MaxPab mouse polyclonal antibody (B01P)
  • AKR1B1 purified MaxPab mouse polyclonal antibody (B01P)

AKR1B1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000231-B01P
AKR1B1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AKR1B1 protein.
Información adicional
Size 50 ug
Gene Name AKR1B1
Gene Alias ADR|ALDR1|ALR2|AR|MGC1804
Gene Description aldo-keto reductase family 1, member B1 (aldose reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR1B1 (AAH00260, 1 a.a. ~ 316 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 231

Enviar un mensaje


AKR1B1 purified MaxPab mouse polyclonal antibody (B01P)

AKR1B1 purified MaxPab mouse polyclonal antibody (B01P)