ALDH3B2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ALDH3B2 purified MaxPab rabbit polyclonal antibody (D01P)

ALDH3B2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000222-D01P
ALDH3B2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ALDH3B2 protein.
Información adicional
Size 100 ug
Gene Name ALDH3B2
Gene Alias ALDH8
Gene Description aldehyde dehydrogenase 3 family, member B2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALDH3B2 (AAH07685.1, 1 a.a. ~ 385 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 222

Enviar un mensaje


ALDH3B2 purified MaxPab rabbit polyclonal antibody (D01P)

ALDH3B2 purified MaxPab rabbit polyclonal antibody (D01P)