AKT2 monoclonal antibody (M05), clone 1F3 Ver mas grande

AKT2 monoclonal antibody (M05), clone 1F3

AB-H00000208-M05

Producto nuevo

AKT2 monoclonal antibody (M05), clone 1F3

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name AKT2
Gene Alias PKBB|PKBBETA|PRKBB|RAC-BETA
Gene Description v-akt murine thymoma viral oncogene homolog 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 208
Clone Number 1F3
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant AKT2.

Consulta sobre un producto

AKT2 monoclonal antibody (M05), clone 1F3

AKT2 monoclonal antibody (M05), clone 1F3