Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AKT2 monoclonal antibody (M03), clone 1D9
Abnova
AKT2 monoclonal antibody (M03), clone 1D9
Ref: AB-H00000208-M03
AKT2 monoclonal antibody (M03), clone 1D9
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AKT2.
Información adicional
Size
100 ug
Gene Name
AKT2
Gene Alias
PKBB|PKBBETA|PRKBB|RAC-BETA
Gene Description
v-akt murine thymoma viral oncogene homolog 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq
MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
208
Clone Number
1D9
Iso type
IgG1 Kappa
Enviar un mensaje
AKT2 monoclonal antibody (M03), clone 1D9
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*