AKT2 monoclonal antibody (M03), clone 1D9
  • AKT2 monoclonal antibody (M03), clone 1D9

AKT2 monoclonal antibody (M03), clone 1D9

Ref: AB-H00000208-M03
AKT2 monoclonal antibody (M03), clone 1D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKT2.
Información adicional
Size 100 ug
Gene Name AKT2
Gene Alias PKBB|PKBBETA|PRKBB|RAC-BETA
Gene Description v-akt murine thymoma viral oncogene homolog 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 208
Clone Number 1D9
Iso type IgG1 Kappa

Enviar un mensaje


AKT2 monoclonal antibody (M03), clone 1D9

AKT2 monoclonal antibody (M03), clone 1D9