AKT1 monoclonal antibody (M26), clone 3E11
  • AKT1 monoclonal antibody (M26), clone 3E11

AKT1 monoclonal antibody (M26), clone 3E11

Ref: AB-H00000207-M26
AKT1 monoclonal antibody (M26), clone 3E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKT1.
Información adicional
Size 100 ug
Gene Name AKT1
Gene Alias AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA
Gene Description v-akt murine thymoma viral oncogene homolog 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 207
Clone Number 3E11
Iso type IgG2a Kappa

Enviar un mensaje


AKT1 monoclonal antibody (M26), clone 3E11

AKT1 monoclonal antibody (M26), clone 3E11