Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AKT1 monoclonal antibody (M01), clone 4C3
Abnova
AKT1 monoclonal antibody (M01), clone 4C3
Ref: AB-H00000207-M01
AKT1 monoclonal antibody (M01), clone 4C3
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AKT1.
Información adicional
Size
100 ug
Gene Name
AKT1
Gene Alias
AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA
Gene Description
v-akt murine thymoma viral oncogene homolog 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
IP,S-ELISA,ELISA,RNAi-Ab,PLA-Ce
Immunogen Prot. Seq
SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AKT1 (AAH00479, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
207
Clone Number
4C3
Iso type
IgG2a Kappa
Enviar un mensaje
AKT1 monoclonal antibody (M01), clone 4C3
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*