JAG1 polyclonal antibody (A01)
  • JAG1 polyclonal antibody (A01)

JAG1 polyclonal antibody (A01)

Ref: AB-H00000182-A01
JAG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant JAG1.
Información adicional
Size 50 uL
Gene Name JAG1
Gene Alias AGS|AHD|AWS|CD339|HJ1|JAGL1|MGC104644
Gene Description jagged 1 (Alagille syndrome)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen JAG1 (NP_000205, 531 a.a. ~ 620 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 182

Enviar un mensaje


JAG1 polyclonal antibody (A01)

JAG1 polyclonal antibody (A01)