Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AGER monoclonal antibody (M05), clone 1D1
Abnova
AGER monoclonal antibody (M05), clone 1D1
Ref: AB-H00000177-M05
AGER monoclonal antibody (M05), clone 1D1
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AGER.
Información adicional
Size
100 ug
Gene Name
AGER
Gene Alias
MGC22357|RAGE
Gene Description
advanced glycosylation end product-specific receptor
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
PAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AGER (AAH20669.1, 87 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
177
Clone Number
1D1
Iso type
IgG2a Kappa
Enviar un mensaje
AGER monoclonal antibody (M05), clone 1D1
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*